Popular Abstract in Swedish Denna avhandling behandlar statiska och dynamiska lagbeslutsproblem i både stokastiska och deterministiska ramverk. Lagproblemet är ett kooperativt spel, där ett antal spelare utgör ett lag som försöker optimera en given kostnad inducerad av omvärldens osäkerhet. Osäkerheten kan modelleras antingen som stokastisk, vilket ger upphov till det stokastiska lag problemet, elThis thesis considers static and dynamic team decision problems in both stochastic and deterministic settings. The team problem is a cooperative game, where a number of players make up a team that tries to optimize a given cost induced by the uncertainty of nature. The uncertainty is modeled as either stochastic, which gives the stochastic team problem, or modelled as deterministic where the team

Aiming for better understanding of the large complexity of excited-state processes in carotenoids, we have studied the excitation wavelength dependence of the relaxation dynamics in the carotenoid zeaxanthin. Excitation into the lowest vibrational band of the S-2 state at 485 nm, into the 0-3 vibrational band of the S2 state at 400 nm, and into the B-2(u)+ state at 266 nm resulted in different rel

The calcium-releasing second messenger inositol 1,4,5-trisphosphate is involved in the regulation of stomatal aperture by ABA. In other signalling pathways, inositol 1,4,5-trisphosphate is generated by the action of phospholipase C. We have studied the importance of phospholipase C in guard cell ABA-signalling pathways. Immunolocalisation of a calcium-activated phospholipase C confirmed the presen

The interaction between acyl chain homologues (C10 and C12) of n-acyl beta-D-maltoside and the antimicrobial peptide LL-37 (LLGDFFRK-SKEKIGKEFKRIVQRIKDFLRNLVPRTES) was investigated. Emphasis was placed on peptide-micelle complexation and its consequences for peptide proteolytic stability, as well as bactericidal and hemolytic effects of the mixed systems. From circular dichroism and liposome leaka

Recent studies have indicated that diets rich in digestible carbohydrates and dietary fibre might be beneficial in the regulation of type II non insulin dependent diabetes (NIDD). Addition of the gel forming type of dietary fibre such as pectin and guar gum to meals or glucose solutions reduces post-prandial glucose and insulin response. Addition of cereal fibres in the form of bran seems to have

Gentrification is a current and often debated concept that concerns social changes in our cities. The concept relates to a development whereby areas earlier inhabited by less wealthy social groups are taken over by middle and upper middle-class residents. In the discussions of these changes, two perspectives have dominated. Representatives for the consumer perspective argue that gentrification occ

Background Acetabular cementation during total hip arthroplasty is considered difficult mainly due to the appearance and anatomy of the acetabulum. Improved cementation technique has been shown to improve the longevity of acetabular components. Method We designed a ceramic model to investigate the effect of varying the initial cement pressurization and cup introduction times on the depth of cemen

In recent years the importance of strong brands has come very much into focus both among theoreticians and practitioners. In order to gain a better understanding of the nature of brand strength, I have chosen to analyse the branding process. The overriding aim of this analysis is to develop a theoretical framework and typology with which to facilitate our understanding of how powerful brands can b

This study investigated attendance of treatment and follow-up characteristics in two samples of suicide attempters with different lengths of follow-up, that is after one month and after three months. They did not differ initially. After one month, most of the treatment non-attenders (32%) had not yet established an outpatient contact after inpatient treatment, while after three months, 38% of the

Background The national hip registers of the Nordic countries provide an opportunity to compare age- and sex-standardized annual incidence of primary total hip replacement (THR) and types of implants used for primary hip osteoarthritis (OA) in Denmark, Finland, Iceland, Norway and Sweden. Methods The data on THR were from the national total hip replacement registries, and population data were from

The sintering of alumina-supported nickel particles has been studied after heat-treatment in ammonia + hydrogen at 523 K and 250 bar. The investigated samples were nickel supported on gamma-alumina, transalumina and alpha-alumina, and co-precipitated nickel oxide-alumina. The sintering process was mainly followed by hydrogen chemisorption. The samples were also characterised by specific surface ar

The main focus of this work is to investigate the performance of some simple radiation models used in the thermal radiative heat transfer calculations in a 55 MWe fixed bed boiler with wet wood-chips as the fuel. An optically thin approach, Rosseland approximation, and the P1-approximation were utilised in the investigation. A new optimised version, as it comes to computational speed, of the expon

Recent immunohistochemical findings suggested that a constitutive nitric oxide synthase (cNOS) resides in endocrine pancreas. Here we provide direct biochemical evidence for the presence of cNOS activity in isolated islets. The regulating influence of this nitric oxide synthase (NOS) activity for islet hormone release was also investigated. We observed that cNOS activity could be quantitated in is

Steady-state and transient-state kinetic experiments have been performed to test the proposal that there is a direct (channelled) transfer of NADH from glyceraldehyde-3-phosphate dehydrogenase to alcohol dehydrogenase. The results lend no support to this proposal, but can be best explained in terms of a free-diffusion mechanism for NADH transfer between the two enzymes.

This paper compares the extraction effectiveness of six different commonly applied extraction techniques for the determination of PCBs in soil. The techniques included are Soxhlet, Soxtec, ultrasonication extraction, supercritical fluid extraction, microwave-assisted extraction and accelerated solvent extraction. For none of the techniques were the extraction conditions optimized, but instead the