Sökresultat

Filtyp

Din sökning på "*" gav 548312 sökträffar

Athlete mental health in the Olympic/Paralympic quadrennium : a multi-societal consensus statement

This consensus statement is the product of the Second International Think Tank on Athlete Mental Health, held on the initiative of the International Society of Sport Psychology. The purposes of the Think Tank were to engage international sport psychology societies and organisations in a discussion about athlete mental health as embedded in an Olympic/Paralympic cycle, and to develop practical reco

Plateaus and jumps in the atmospheric radiocarbon record - Potential origin and value as global age markers for glacial-to-deglacial paleoceanography, a synthesis

Changes in the geometry of ocean meridional overturning circulation (MOC) are crucial in controlling past changes of climate and the carbon inventory of the atmosphere. However, the accurate timing and global correlation of short-term glacial-to-deglacial changes of MOC in different ocean basins still present a major challenge. The fine structure of jumps and plateaus in atmospheric and planktic r

Gravitoviscous protoplanetary disks with a dust component : III. Evolution of gas, dust, and pebbles

Aims. We study the dynamics and growth of dust particles in circumstellar disks of different masses that are prone to gravitational instability during the critical first Myr of their evolution. Methods. We solved the hydrodynamics equations for a self-gravitating and viscous circumstellar disk in a thin-disk limit using the FEOSAD numerical hydrodynamics code. The dust component is made up of two

The Rearing Environment and Risk for Major Depression : A Swedish National High-Risk Home-Reared and Adopted-Away Co-Sibling Control Study

Objective: The authors sought to clarify the role of rearing environment in the etiology of major depression. Methods: Defining high risk as having at least one biological parent with major depression, the authors identified a Swedish National Sample of 666 high-risk full sibships and 2,596 high-risk half sibships containing at least one homereared and one adopted-away sibling. Major depression wa

A reliable reflection? : Challenges when documenting physical infrastructure

Minor revisions, deadline 31 januari 2021Maintaining infrastructures such as roads, bridges, railways and other civil constructions requires long term documentation that ideally should comprise a reliable reflection of the physical structures. However, the Swedish Transport Administration (TRA) states that its documentation is currently inadequate and that new working method are needed. The purpose of this paper is to study how the agenc

MicroRNA networks in pancreatic islet cells : Normal function and type 2 diabetes

Impaired insulin secretion from the pancreatic β-cells is central in the pathogenesis of type 2 diabetes (T2D), and microRNAs (miRNAs) are fundamental regulatory factors in this process. Differential expression of miRNAs contributes to β-cell adaptation to compensate for increased insulin resistance, but deregulation of miRNA expression can also directly cause β-cell impairment during the developm

Crystallography of low Z material at ultrahigh pressure : Case study on solid hydrogen

Diamond anvil cell techniques have been improved to allow access to the multimegabar ultrahigh-pressure region for exploring novel phenomena in condensed matter. However, the only way to determine crystal structures of materials above 100 GPa, namely, X-ray diffraction (XRD), especially for low Z materials, remains nontrivial in the ultrahigh-pressure region, even with the availability of brillian

Using cost-benefit analysis to understand adoption of winter cover cropping in California's specialty crop systems

Winter cover crops could contribute to more sustainable agricultural production and increase resiliency to climate change; however, their adoption remains low in California. This paper seeks to understand barriers to winter cover crop adoption by monetizing their long-term economic and agronomic impacts on farm profitability in two of California's specialty crop systems: processing tomatoes and al

Prognostic and predictive performance of R-ISS with SKY92 in older patients with multiple myeloma : The HOVON-87/NMSG-18 trial

The standard prognostic marker for multiple myeloma (MM) patients is the revised International Staging System (R-ISS). However, there is room for improvement in guiding treatment. This applies particularly to older patients, in whom the benefit/risk ratio is reduced because of comorbidities and subsequent side effects. We hypothesized that adding gene-expression data to R-ISS would generate a stro

Atomic-Scale Tuning of Graphene/Cubic SiC Schottky Junction for Stable Low-Bias Photoelectrochemical Solar-to-Fuel Conversion

Engineering tunable graphene-semiconductor interfaces while simultaneously preserving the superior properties of graphene is critical to graphene-based devices for electronic, optoelectronic, biomedical, and photoelectrochemical applications. Here, we demonstrate this challenge can be surmounted by constructing an interesting atomic Schottky junction via epitaxial growth of high-quality and unifor

Modelling heat recovery potential from household wastewater

There is a strongly growing interest for wastewater heat recovery (WWHR) in Sweden and elsewhere, but a lack of adequate tools to determine downstream impacts due to the associated temperature drop. The heat recovery potential and associated temperature drop after heat recovery on a building level is modelled for a case study in Linköping, Sweden. The maximum temperature drop reaches 4.2 °C, with

Calculation of the effective external dose rate to a person staying in the resettlement zone of the Vetka district of the Gomel region of Belarus based on in situ and ex situ assessments in 2016–2018

The aim of this study was to perform a preliminary assessment of the expected effective dose rate from external exposure to an adult individual staying at that part of the radioactively contaminated territory of the Vetka district of the Gomel region of the Republic of Belarus, from where residents had been resettled after the Chernobyl accident. For this assessment, in summer 2016 and 2018 soil s

Travel time and perinatal mortality after emergency caesarean sections : An evaluation of the 2-hour proximity indicator in Sierra Leone

Introduction Longer travel times are associated with increased adverse maternal and perinatal outcomes. Geospatial modelling has been increasingly used to estimate geographic proximity in emergency obstetric care. In this study, we aimed to assess the correlation between modelled and patient-reported travel times and to evaluate its clinical relevance. Methods Women who delivered by caesarean sect

Central exclusive production of scalar and pseudoscalar charmonia in the light-front kT -factorization approach

We study exclusive production of scalar χc0χc(0++) and pseudoscalar ηc charmonia states in proton-proton collisions at the LHC energies. The amplitudes for gg→χc0 as well as for gg→ηc mechanisms are derived in the kT-factorization approach. The pp→ppηc reaction is discussed for the first time. We have calculated rapidity, transverse momentum distributions, and such correlation observables as the d

Search for Heavy Resonances Decaying into a Photon and a Hadronically Decaying Higgs Boson in pp Collisions at s =13 TeV with the ATLAS Detector

This Letter presents a search for the production of new heavy resonances decaying into a Higgs boson and a photon using proton-proton collision data at s=13 TeV collected by the ATLAS detector at the LHC. The data correspond to an integrated luminosity of 139 fb-1. The analysis is performed by reconstructing hadronically decaying Higgs boson (H→bb¯) candidates as single large-radius jets. A novel

Membrane interactions of antimicrobial peptide-loaded microgels

In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta potential, ellipsometry, and circul

Micro(RNA) Management and Mismanagement of the Islet

Pancreatic β-cells located within the islets of Langerhans play a central role in metabolic control. The main function of these cells is to produce and secrete insulin in response to a rise in circulating levels of glucose and other nutrients. The release of insufficient insulin to cover the organism needs results in chronic hyperglycemia and diabetes development. β-cells insure a highly specializ

Microparticle acoustophoresis in aluminum-based acoustofluidic devices with PDMS covers

We present a numerical model for the recently introduced simple and inexpensive micromachined aluminum devices with a polydimethylsiloxane (PDMS) cover for microparticle acoustophoresis. We validate the model experimentally for a basic design, where a microchannel is milled into the surface of an aluminum substrate, sealed with a PDMS cover, and driven at MHz frequencies by a piezoelectric lead-zi

Are judges influenced by legally irrelevant circumstances?

Judges should not be influenced by legally irrelevant circumstances in their legal decision making and judges generally believe that they manage legally irrelevant circumstances well. The purpose of this experimental study was to investigate whether this self-image is correct. Swedish judges (N = 256) read a vignette depicting a case of libel, where a female student had claimed on her blog that sh