Plasma biomarkers of amyloid, tau, and neurodegeneration (ATN) need to be characterized in cognitively unimpaired (CU) elderly individuals. We therefore tested if plasma measurements of amyloid-β (Aβ)42/40, phospho-tau217 (P-tau217), and neurofilament light (NfL) together predict clinical deterioration in 435 CU individuals followed for an average of 4.8 ± 1.7 years in the BioFINDER study. A combi

Partially unfolded alpha-lactalbumin forms the oleic acid complex HAMLET, with potent tumoricidal activity. Here we define a peptide-based molecular approach for targeting and killing tumor cells, and evidence of its clinical potential (ClinicalTrials.gov NCT03560479). A 39-residue alpha-helical peptide from alpha-lactalbumin is shown to gain lethality for tumor cells by forming oleic acid complex

Supercritical heat transfer deterioration can be found in active regenerative cooling processes. Thermal pyrolysis occurs once the temperature of the hydrocarbon fuel exceeds a certain value. To investigate the influence of thermal pyrolysis on the heat transfer behavior and flow-upward characteristics in a rectangular channel, the wall temperature distribution, thermal acceleration, mass fraction

The interpretation of reflexive pronouns has been the topic of extensive linguistic research. This paper illustrates how different types of reflexive pronouns can be inter-preted and generated within the framework of Referent Grammar, a grammar which can be run directly on the computer. The rules illustrated are to be used in the machine translation project SWETRA which translates between English,

A literature review of methods where different hazards are combined into a multi-hazard index or method are presented in this report. The purpose of the review is to get an insight into approaches to combine different hazards into a multi-hazard index or method.To directly combine hazards, it is necessary to present them with the same unit of measure. This can be done with different measures for nA literature review of methods where different hazards are combined into a multi-hazard index or method are presented in this report. The purpose of the review is to get an insight into approaches to combine different hazards into a multi-hazard index or method. To directly combine hazards, it is necessary to present them with the same unit of measure. This can be done with different measures for

Neutrophils form sticky web-like structures known as neutrophil extracellular traps (NETs) as part of innate immune response. NETs are decondensed extracellular chromatin filaments comprising nuclear and cytoplasmic proteins. NETs have been implicated in many gastrointestinal diseases including colorectal cancer (CRC). However, the regulatory mechanisms of NET formation and potential pharmacologic

Cone calorimeter and controlled atmosphere cone calorimeter experiments were conducted on various samples. The intent of the tests was to examine the behavior of uniform and composite samples in a range of thicknesses, irradiances, and oxygen concentrations. Single, uniform layers of acrylonitrile butadiene styrene (ABS) were compared to a composite mix, comprising of ABS with a surface layer of c

From 1985 to 2016, the prevalence of underweight decreased, and that of obesity and severe obesity increased, in most regions, with significant variation in the magnitude of these changes across regions. We investigated how much change in mean body mass index (BMI) explains changes in the prevalence of underweight, obesity, and severe obesity in different regions using data from 2896 population-ba

In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a "spiky"external surface, as well as to nonporous silica nanoparticles. For this, we employed a combinat

Objective: To assess the 52-week incidence proportion and incidence rate of sports-related concussion (SRC) among elite Para athletes, and to analyze the injury mechanisms.Method: In total, 70 male and 37 female Swedish elite Para athletes (median age 29 years) with vision, physical and intellectual impairment, weekly self-reported sports-related injuries including concussion in an eHealth applica

This paper examines how agents inscribed their persona in buildings during the Renaissance in Scania in present-day Sweden. Through an analysis of stone tablets and timber beams with inscriptions, images, and dates, questions of identity and individuality are highlighted. The objects were often placed above doors in noble country residences or in buildings belonging to the urban elite. The paper d

After the fall of Communism, the Serbian Orthodox Church has experienced a significant revival, part of which has been the recollection of past events, personas, sites and shrines in order to re-establish its position in the post-Yugoslav republics. One of these processes of recollection is devoted to the cult of St. Jovan Vladimir (d.1016) and the sites associated with him in southern Montenegro.

Detta är slutrapporten för forskningsprojektet DATA/TRUST: Tillitsbaserad personuppgiftshantering i den digitala ekonomin som letts av Stefan Larsson, lektor och docent vid institutionen för teknik och samhälle, LTH, Lunds universitet.Projektets syfte har varit att bättre förstå vilka utmaningar och vilka möjligheter handeln står inför när det gäller insamling och användning av individers data uti