Search results

Filter

Filetype

Your search for "*" yielded 534193 hits

Neutrophil extracellular traps in colorectal cancer progression and metastasis

Neutrophils form sticky web-like structures known as neutrophil extracellular traps (NETs) as part of innate immune response. NETs are decondensed extracellular chromatin filaments comprising nuclear and cytoplasmic proteins. NETs have been implicated in many gastrointestinal diseases including colorectal cancer (CRC). However, the regulatory mechanisms of NET formation and potential pharmacologic

Burning material behaviour in hypoxic environments : An experimental study examining a representative storage arrangement of acrylonitrile butadiene styrene, polyethylene bubble wrap, and cardboard layers as a composite system

Cone calorimeter and controlled atmosphere cone calorimeter experiments were conducted on various samples. The intent of the tests was to examine the behavior of uniform and composite samples in a range of thicknesses, irradiances, and oxygen concentrations. Single, uniform layers of acrylonitrile butadiene styrene (ABS) were compared to a composite mix, comprising of ABS with a surface layer of c

Heterogeneous contributions of change in population distribution of body mass index to change in obesity and underweight

From 1985 to 2016, the prevalence of underweight decreased, and that of obesity and severe obesity increased, in most regions, with significant variation in the magnitude of these changes across regions. We investigated how much change in mean body mass index (BMI) explains changes in the prevalence of underweight, obesity, and severe obesity in different regions using data from 2896 population-ba

Membrane Interactions of Virus-like Mesoporous Silica Nanoparticles

In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a "spiky"external surface, as well as to nonporous silica nanoparticles. For this, we employed a combinat

Incidence of sports-related concussion in elite para athletes : a 52-week prospective study

Objective: To assess the 52-week incidence proportion and incidence rate of sports-related concussion (SRC) among elite Para athletes, and to analyze the injury mechanisms.Method: In total, 70 male and 37 female Swedish elite Para athletes (median age 29 years) with vision, physical and intellectual impairment, weekly self-reported sports-related injuries including concussion in an eHealth applica

Inscriptions and Images in Secular Buildings : Examples from Renaissance Scania, Sweden, ca. 1450–1658

This paper examines how agents inscribed their persona in buildings during the Renaissance in Scania in present-day Sweden. Through an analysis of stone tablets and timber beams with inscriptions, images, and dates, questions of identity and individuality are highlighted. The objects were often placed above doors in noble country residences or in buildings belonging to the urban elite. The paper d

The forging and forgetting the cult of St. Jovan Vladimir in contemporary montenegro

After the fall of Communism, the Serbian Orthodox Church has experienced a significant revival, part of which has been the recollection of past events, personas, sites and shrines in order to re-establish its position in the post-Yugoslav republics. One of these processes of recollection is devoted to the cult of St. Jovan Vladimir (d.1016) and the sites associated with him in southern Montenegro.

Tillit i den datadrivna handeln

Detta är slutrapporten för forskningsprojektet DATA/TRUST: Tillitsbaserad personuppgiftshantering i den digitala ekonomin som letts av Stefan Larsson, lektor och docent vid institutionen för teknik och samhälle, LTH, Lunds universitet.Projektets syfte har varit att bättre förstå vilka utmaningar och vilka möjligheter handeln står inför när det gäller insamling och användning av individers data uti

Heparin-binding protein in lower airway samples as a biomarker for pneumonia

Objectives: Ventilator-associated pneumonia (VAP) is difficult to diagnose using clinical criteria and no biomarkers have yet been proved to be sufficiently accurate. The use of the neutrophil-derived Heparin-binding protein (HBP) as a biomarker for pneumonia was investigated in this exploratory case–control study in two intensive care units at a tertiary referral hospital. Methods: Patients with

Combination treatment with U0126 and rt-PA prevents adverse effects of the delayed rt-PA treatment after acute ischemic stroke

In acute ischemic stroke, the only FDA-approved drug; recombinant tissue plasminogen activator (rt-PA) is limited by restricted time-window due to an enhanced risk of hemorrhagic transformation which is thought to be caused by metalloproteinase (MMP). In experimental stroke inhibitors of the mitogen–activated protein kinase kinase extracellular signal–regulated kinase kinase (MEK) 1/2 pathways red

A comprehensive review on the application of hybrid nanofluids in solar energy collectors

Over the years, nanofluids have proved to be beneficial in various heat transfer applications, particularly in solar energy collectors. Hybrid nanofluids have also shown promise in such applications due to their enhanced thermal conductivity relative to mono-nanofluids and to pure fluids. The aim of this review paper is to scrutinize recent research in this topic in order to identify the key advan

Climate Change and Subsistence Exchange in Southern California : Was Western Sea-Purslane a Channel Island Trade Good?

A popular model for social evolution in the Santa Barbara Channel region holds that, during times of resource stress, islanders would trade with mainlanders for plant foods in order to supplement island diets. Recently, western sea-purslane (Sesuvium verrucosum) has been suggested as a primary food product involved in this exchange. This report presents new caloric values for Sesuvium verrucosum a

Bearing the brunt of warming: Interactions between carbon and hydrology in northern Sweden

Climate modelling studies indicate that subarctic ecosystems are predicted to show some of the earliest responses to climate change. The predicted temperature and precipitation changes have implications for the carbon biogeochemical cycle with ancillary effects in permafrost soils, vegetation, and stream networks. Browning, a result of changes in dissolved organic carbon (DOC) export to river syst