Data philanthropy, which is firm donations of data, data scientists, and data technologies for social good, is a powerful new phenomenon that offers benefits to both donor firms and society. In this explorative research we unpack data philanthropy, providing definitions, and examples along with a theoretical perspective from corporate philanthropy and strategic management. We view data through a l

Objective To understand and report on the impact of the COVID-19 pandemic on the everyday lives of frail older persons living in nursing homes by exploring their experiences of how the pandemic-related restrictions had influenced them and in what way. Design Empirical qualitative interview study. Setting A publicly run nursing home in an urban area in Sweden in June 2020. The nursing home had visi

Cooperative binding is a key feature of metabolic pathways, signaling, and transport processes. It provides tight regulation over a narrow concentration interval of a ligand, thus enabling switching to be triggered by small concentration variations. The data presented in this work reveal strong positive cooperativity of α-synuclein binding to phospholipid membranes. Fluorescence cross-correlation

Intermittent fasting may impart metabolic benefits independent of energy balance by initiating fasting-mediated mechanisms. This randomized controlled trial examined 24-hour fasting with 150% energy intake on alternate days for 3 weeks in lean, healthy individuals (0:150; n = 12). Control groups involved a matched degree of energy restriction applied continuously without fasting (75% energy intake

From 1985 to 2016, the prevalence of underweight decreased, and that of obesity and severe obesity increased, in most regions, with significant variation in the magnitude of these changes across regions. We investigated how much change in mean body mass index (BMI) explains changes in the prevalence of underweight, obesity, and severe obesity in different regions using data from 2896 population-ba

In the present study, we investigated lipid membrane interactions of silica nanoparticles as carriers for the antimicrobial peptide LL-37 ([LL-37, 37 aa]). In doing so, smooth mesoporous nanoparticles were compared to virus-like mesoporous nanoparticles, characterized by a "spiky"external surface, as well as to nonporous silica nanoparticles. For this, we employed a combinat

Aims. Spatial distribution and growth of dust in a clumpy protoplanetary disk subject to vigorous gravitational instability and fragmentation is studied numerically with sub-au resolution using the FEOSAD code. Methods. Hydrodynamics equations describing the evolution of self-gravitating and viscous protoplanetary disks in the thin-disk limit were modified to include a dust component consisting of

For the reduction of emissions and combustion noise in an internal combustion diesel engine, multiple injections are normally used. A pilot injection reduces the ignition delay of the main injection and hence the combustion noise. However, normal variations of the operating conditions, component tolerances, and aging may result in the lack of combustion i.e. pilot misfire. The result is a lower in

We present the X-ray spectroscopic study of the Compton-thick (CT) active galactic nuclei (AGN) population within the Chandra Deep Field South (CDF-S) by using the deepest X-ray observation to date, the Chandra 7 Ms observation of the CDF-S. We combined an optimized version of our automated selection technique and a Bayesian Monte Carlo Markov chains (MCMC) spectral fitting procedure, to develop a

A key factor for the insulin response to oral glucose is the pro-glucagon derived incretin hormone glucagon-like peptide-1 (GLP-1), together with the companion incretin hormone, glucose-dependent insulinotropic polypeptide (GIP). Studies in GIP and GLP-1 receptor knockout (KO) mice have been undertaken in several studies to examine this role of the incretin hormones. In the present study, we revie

In 1876, the Kaitakushi, the Japanese government agency responsible for the settlement of the northern island of Hokkaido, hired three Americans from Massachusetts Agricultural College: William Smith Clark, William Wheeler and David Pearce Penhallow. Their task was to establish a comparable institution in Hokkaido, Sapporo Agricultural College, that would spread American-style scientific agricultu

Were the ordinary citizens of imperial metropoles during the 19th and 20th centuries arduous supporters or apathetic observers of their country's colonial expansionism, or did their relationship to empire fall somewhere in between? Although this is a central question for understanding the how and why of modern imperialism and evaluating responsibility for colonial wrongs, scholars in the only loos

Objective: To assess the 52-week incidence proportion and incidence rate of sports-related concussion (SRC) among elite Para athletes, and to analyze the injury mechanisms.Method: In total, 70 male and 37 female Swedish elite Para athletes (median age 29 years) with vision, physical and intellectual impairment, weekly self-reported sports-related injuries including concussion in an eHealth applica

This paper examines how agents inscribed their persona in buildings during the Renaissance in Scania in present-day Sweden. Through an analysis of stone tablets and timber beams with inscriptions, images, and dates, questions of identity and individuality are highlighted. The objects were often placed above doors in noble country residences or in buildings belonging to the urban elite. The paper d

This paper examines the lasting impact of the alignment of African countries during the Cold War on their modern economic development. We find that the division of the continent into two blocs (East/West) led to two clusters of development outcomes that reflect the Cold War’s ideological divide. To determine alignment, we introduce a non-cooperative game of social interactions where each country c

After the fall of Communism, the Serbian Orthodox Church has experienced a significant revival, part of which has been the recollection of past events, personas, sites and shrines in order to re-establish its position in the post-Yugoslav republics. One of these processes of recollection is devoted to the cult of St. Jovan Vladimir (d.1016) and the sites associated with him in southern Montenegro.