Search results

Filter

Filetype

Your search for "*" yielded 552595 hits

Central exclusive production of scalar and pseudoscalar charmonia in the light-front kT -factorization approach

We study exclusive production of scalar χc0χc(0++) and pseudoscalar ηc charmonia states in proton-proton collisions at the LHC energies. The amplitudes for gg→χc0 as well as for gg→ηc mechanisms are derived in the kT-factorization approach. The pp→ppηc reaction is discussed for the first time. We have calculated rapidity, transverse momentum distributions, and such correlation observables as the d

Search for Heavy Resonances Decaying into a Photon and a Hadronically Decaying Higgs Boson in pp Collisions at s =13 TeV with the ATLAS Detector

This Letter presents a search for the production of new heavy resonances decaying into a Higgs boson and a photon using proton-proton collision data at s=13 TeV collected by the ATLAS detector at the LHC. The data correspond to an integrated luminosity of 139 fb-1. The analysis is performed by reconstructing hadronically decaying Higgs boson (H→bb¯) candidates as single large-radius jets. A novel

Membrane interactions of antimicrobial peptide-loaded microgels

In the present study, lipid membrane interactions of anionic poly(ethyl acrylate-co-methacrylic acid) (MAA) microgels as carriers for the cationic antimicrobial peptide LL-37 ([LL-37, 37 aa]) were investigated. In doing so, neutron reflectometry (NR), Fourier-transform infrared spectroscopy with attenuated total reflection (FTIR-ATR), zeta potential, ellipsometry, and circul

Micro(RNA) Management and Mismanagement of the Islet

Pancreatic β-cells located within the islets of Langerhans play a central role in metabolic control. The main function of these cells is to produce and secrete insulin in response to a rise in circulating levels of glucose and other nutrients. The release of insufficient insulin to cover the organism needs results in chronic hyperglycemia and diabetes development. β-cells insure a highly specializ

Microparticle acoustophoresis in aluminum-based acoustofluidic devices with PDMS covers

We present a numerical model for the recently introduced simple and inexpensive micromachined aluminum devices with a polydimethylsiloxane (PDMS) cover for microparticle acoustophoresis. We validate the model experimentally for a basic design, where a microchannel is milled into the surface of an aluminum substrate, sealed with a PDMS cover, and driven at MHz frequencies by a piezoelectric lead-zi

Are judges influenced by legally irrelevant circumstances?

Judges should not be influenced by legally irrelevant circumstances in their legal decision making and judges generally believe that they manage legally irrelevant circumstances well. The purpose of this experimental study was to investigate whether this self-image is correct. Swedish judges (N = 256) read a vignette depicting a case of libel, where a female student had claimed on her blog that sh

Inhibition of NFAT signaling restores microvascular endothelial function in diabetic mice

Central to the development of diabetic macro- and microvascular disease is endothelial dysfunction, which appears well before any clinical sign but, importantly, is potentially reversible. We previously demonstrated that hyperglycemia activates nuclear factor of activated T cells (NFAT) in conduit and medium-sized resistance arteries and that NFAT blockade abolishes diabetes-driven aggravation of

Mapping mafic dyke swarms, structural features, and hydrothermal alteration zones in Atar, Ahmeyim and Chami areas (Reguibat Shield, Northern Mauritania) using high-resolution aeromagnetic and gamma-ray spectrometry data

Analysis of an airborne geophysical data covering the Tasiast-Tijirit Terrane in the western part of the Reguibat Shield (including the 1:200,000 geological sheets of Chami, Ahmeyim and Atar), provided an improved mapping of mafic dyke swarms, structural features, and hydrothermal alteration zones. It also extended the mapping into extensive areas covered by sand. A low-altitude (100 m) airborne s

Lower 68Ga-DOTATOC uptake in nonfunctioning pituitary neuroendocrine tumours compared to normal pituitary gland—A proof-of-concept study

Objectives: 68Ga-DOTATOC PET targets somatostatin receptors (SSTRs) and is well established for the detection of SSTR-expressing tumors, such as gastrointestinal neuroendocrine tumors. Pituitary adenomas, recently designated as pituitary neuroendocrine tumors (PitNETs), also express SSTRs, but there has been no previous evaluations of 68Ga-DOTATOC PET in PitNET patients. The aim of this pilot stud

Hyperbaric oxygen therapy in diabetic foot ulceration : Useless or useful? A battle

The use of hyperbaric oxygen therapy (HBO) in the treatment of certain types of diabetic foot ulcers (DFU) has been the topic of much debate and disagreement over the last several decades. In this review, the evidence for its use is presented and discussed by two experts in DFU management. Whereas some randomized controlled trials suggest that HBO may speed the healing of certain ischaemic or neur

DIFFUSE RETINAL VASCULAR LEAKAGE AND CONE-ROD DYSTROPHY IN A FAMILY WITH THE HOMOZYGOUS MISSENSE C.1429G>A (P.GLY477ARG) MUTATION IN CRB1

PURPOSE: To describe a specific cone-rod dystrophy phenotype in a family with the homozygous c.1429G>A; p.Gly477Arg mutation in CRB1. The detailed phenotype of subjects with this specific mutation has not been described previously. METHODS: Clinical examination included full-field electroretinography and high-resolution and widefield retinal imaging and uveitis workup. Molecular genetic analysis i

Gold nanoparticles incorporated into cryogel walls for efficient nitrophenol conversion

The past several decades have illustrated an enormous interest in noble metal nanoparticles for their superior catalytic activity, however, their industrial use is very restricted due to inefficient recovery leading to potential contamination of products and the environment. Immobilised nanoparticles illustrate promising results for scaling up processes, and can be successfully applied for various

Search for resonances decaying into a weak vector boson and a Higgs boson in the fully hadronic final state produced in proton-proton collisions at s =13 TeV with the ATLAS detector

A search for heavy resonances decaying into a W or Z boson and a Higgs boson produced in proton-proton collisions at the Large Hadron Collider at s=13 TeV is presented. The analysis utilizes the dominant W→qq¯′ or Z→qq¯ and H→bb¯ decays with substructure techniques applied to large-radius jets. A sample corresponding to an integrated luminosity of 139 fb-1 collected with the ATLAS detector is anal

The GALAH survey : A new constraint on cosmological lithium and Galactic lithium evolution from warm dwarf stars

Lithium depletion and enrichment in the cosmos is not yet well understood. To help tighten constraints on stellar and Galactic evolution models, we present the largest high-resolution analysis of Li abundances A(Li) to date, with results for over $100\, 000$ GALAH (Galactic Archeology with HERMES) field stars spanning effective temperatures $5900\, \mathrm{K} \lesssim T_{\mathrm{eff}}\lesssim 7000

Multiplicity and pseudo-rapidity density distributions of charged particles produced in pp, pA and AA collisions at RHIC & LHC energies

Multiplicity and pseudorapidity (η) density (dN ch/dη) distributions of charged hadrons provide key information towards understanding the particle production mechanisms and initial conditions of high-energy heavy-ion collisions. However, detector constraints limit the η-range across which charged particle measurements can be carried out. Extrapolating the measured distributions to large η-range by

Ambulatory oxygen for treatment of exertional hypoxaemia in pulmonary fibrosis (PFOX trial) : A randomised controlled trial

Introduction Interstitial lung diseases are characterised by scarring of lung tissue that leads to reduced transfer of oxygen into the blood, decreased exercise capacity and premature death. Ambulatory oxygen therapy may be used to treat exertional oxyhaemoglobin desaturation, but there is little evidence to support its efficacy and there is wide variation in clinical practice. This study aims to

Access to infertility evaluation and treatment in two public fertility clinics and the reasons for withholding it : A prospective survey cohort study of healthcare professionals

Objectives Study the proportion of patients affected by involuntary childlessness who are denied fertility treatment and the reasons behind this in a publicly funded healthcare system. Design Survey study using prospectively collected information by healthcare professionals. Setting Two university-affiliated fertility clinics in Sweden. Participants Single women and couples in heterosexual and hom

Trait Disinhibition and NoGo Event-Related Potentials in Violent Mentally Disordered Offenders and Healthy Controls

Trait disinhibition may function as a dispositional liability toward maladaptive behaviors relevant in the treatment of mentally disordered offenders (MDOs). Reduced amplitude and prolonged latency of the NoGo N2 and P3 event-related potentials have emerged as promising candidates for transdiagnostic, biobehavioral markers of trait disinhibition, yet no study has specifically investigated these tw

Atmospheric circulation over Europe during the Younger Dryas

The Younger Dryas (YD) was a period of rapid climate cooling that occurred at the end of the last glaciation. Here, we present the first palaeoglacier-derived reconstruction of YD precipitation across Europe, determined from 122 reconstructed glaciers and proxy atmospheric temperatures. Positive precipitation anomalies (YD versus modern) are found along much of the western seaboard of Europe and a